RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF2526 domain-containing protein YdcY Amino Acid Sequence


Size: 77

Fasta

 

>DUF2526 domain-containing protein YdcY E. coli K12. Version NC_000913.3 GI:556503834
MSHLDEVIARVDAAIEESVIAHMNELLIALSDDAELSREDRYTQQQRLRTAIAHHGRKHK
EDMEARHEQLTKGGTIL
              
                            

Download fasta file
RegulonDB