RegulonDB RegulonDB 10.8: Amino acid Sequence
DNA-binding transcriptional dual regulator McbR Amino Acid Sequence


Size: 221

Fasta

 

>DNA-binding transcriptional dual regulator McbR E. coli K12. Version NC_000913.3 GI:556503834
MPGTGKMKHVSLTLQVENDLKHQLSIGALKPGARLITKNLAEQLGMSITPVREALLRLVS
VNALSVAPAQAFTVPEVGKRQLDEINRIRYELELMAVALAVENLTPQDLAELQELLEKLQ
QAQEKGDMEQIINVNRLFRLAIYHRSNMPILCEMIEQLWVRMGPGLHYLYEAINPAELRE
HIENYHLLLAALKAKDKEGCRHCLAEIMQQNIAILYQQYNR
              
                            

Download fasta file
RegulonDB