RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF5445 domain-containing protein YncH Amino Acid Sequence


Size: 70

Fasta

 

>DUF5445 domain-containing protein YncH E. coli K12. Version NC_000913.3 GI:556503834
MVCFLIYITLLFIQRVYFISSEKKLTIHIVQMFQLLSQAFYNLKMFLMMDMLGVGDAINI
NTNKNIRQVC
              
                            

Download fasta file
RegulonDB