RegulonDB RegulonDB 10.9: Amino acid Sequence
putative transposase YncI Amino Acid Sequence


Size: 350

Fasta

 

>putative transposase YncI E. coli K12. Version NC_000913.3 GI:556503834
MSIQSLLDYISVTPDIRQQGKVKHKLSAILFLTVCAVIAGADEWQEIEDFGHERLEWLKK
YGDFDNGIPVDDTIARVVSNIDSLAFEKMFIEWMQECHEITDGEIIAIDGKTIRGSFDKG
KRKGAIHMVSAFSNENGVVLGQVKTEAKSNEITAIPELLNLLYLKKNLITIDAMGCQKDI
ASKIKDKKADYLLAVKGNQGKLHHAFEEKFPVNVFSNYKGDSFSTQEISHGRKETRLHIV
SNVTPELL*F*IRMEGIKKALCSIVIQAEERR*ISRRCKHPILYFIKGYGC*RICTCYQS
ALADRAQSSLGVRCKNE*RCQPDKKRKRSLNNIWNKEDGTEFIKRLQRH*
              
                            

Download fasta file
RegulonDB