RegulonDB RegulonDB 10.10: Amino acid Sequence
arylamine N-acetyltransferase Amino Acid Sequence


Size: 281

Fasta

 

>arylamine N-acetyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MTPILNHYFARINWSGAAAVNIDTLRALHLKHNCTIPFENLDVLLPREIQLDNQSPEEKL
VIARRGGYCFEQNGVFERVLRELGFNVRSLLGRVVLSNPPALPPRTHRLLLVELEEEKWI
ADVGFGGQTLTAPIRLVSDLVQTTPHGEYRLLQEGDDWVLQFNHHQHWQSMYRFDLCEQQ
QSDYVMGNFWSAHWPQSHFRHHLLMCRHLPDGGKLTLTNFHFTHYENGHAVEQRNLPDVA
SLYAVMQEQFGLGVDDAKHGFTVDELALVMAAFDTHPEAGK
              
                            

Download fasta file
RegulonDB