RegulonDB RegulonDB 10.10: Amino acid Sequence
divisome localized glycosyl hydrolase Amino Acid Sequence


Size: 439

Fasta

 

>putative lipoprotein YddW E. coli K12. Version NC_000913.3 GI:556503834
MDICSRNKKLTIRRPAILVALALLLCSCKSTPPESMVTPPAGSKPPATTQQSSQPMRGIW
LATVSRLDWPPVSSVNISNPTSRARVQQQAMIDKLDHLQRLGINTVFFQVKPDGTALWPS
KILPWSDLMTGKIGENPGYDPLQFMLDEAHKRGMKVHAWFNPYRVSVNTKPGTIRELNST
LSQQPASVYVQHRDWIRTSGDRFVLDPGIPEVQDWITSIVAEVVSRYPVDGVQFDDYFYT
ESPGSRLNDNETYRKYGGAFASKADWRRNNTQQLIAKVSHTIKSIKPGVEFGVSPAGVWR
NRSHDPLGSDTRGAAAYDESYADTRRWVEQGLLDYIAPQIYWPFSRSAARYDVLAKWWAD
VVKPTRTRLYIGIAFYKVGEPSKIEPDWMINGGVPELKKQLDLNDAVPEISGTILFREDY
LNKPQTQQAVSYLQSRWGS
              
                            

Download fasta file
RegulonDB