RegulonDB RegulonDB 10.9: Amino acid Sequence
two-component system connector SafA Amino Acid Sequence


Size: 65

Fasta

 

>two-component system connector SafA E. coli K12. Version NC_000913.3 GI:556503834
MHATTVKNKITQRDNYKEIMSAIVVVLLLTLTLIAIFSAIDQLSISEMGRIARDLTHFII
NSLQG
              
                            

Download fasta file
RegulonDB