RegulonDB RegulonDB 10.9: Amino acid Sequence
autoinducer-2 kinase Amino Acid Sequence


Size: 530

Fasta

 

>autoinducer-2 kinase E. coli K12. Version NC_000913.3 GI:556503834
MARLFTLSESKYYLMALDAGTGSIRAVIFDLEGNQIAVGQAEWRHLAVPDVPGSMEFDLN
KNWQLACECMRQALHNAGIAPEYIAAVSACSMREGIVLYNNEGAPIWACANVDARAAREV
SELKELHNNTFENEVYRATGQTLALSAIPRLLWLAHHRSDIYRQASTITMISDWLAYMLS
GELAVDPSNAGTTGLLDLTTRDWKPALLDMAGLRADILSPVKETGTLLGVVSSQAAELCG
LKAGTPVVVGGGDVQLGCLGLGVVRPAQTAVLGGTFWQQVVNLAAPVTDPEMNVRVNPHV
IPGMVQAESISFFTGLTMRWFRDAFCAEEKLIAERLGIDTYTLLEEMASRVPPGSWGVMP
IFSDRMRFKTWYHAAPSFINLSIDPDKCNKATLFRALEENAAIVSACNLQQIADFSNIHP
SSLVFAGGGSKGKLWSQILADVSGLPVNIPVVKEATALGCAIAAGVGAGIFSSMAETGER
LVRWERTHTPDPEKHELYQDSRDKWQAVYQDQLGLVDHGLTTSLWKAPGL
              
                            

Download fasta file
RegulonDB