RegulonDB RegulonDB 10.9: Amino acid Sequence
protein YneK Amino Acid Sequence


Size: 371

Fasta

 

>protein YneK E. coli K12. Version NC_000913.3 GI:556503834
MVTPVSISNYISLPDDFPVRNIAPQVKEVLKDFIDALSTIICNEEWRTSLNINSATKKIF
NNLDNLSYIQRTSFRGNDTLYNEKVQFKLTYPARNGRHKENIEFQVVINLSPIYLDNFRH
DGEINIFCAPNPKPVTMGRVFQTGVERVLFLFLNDFIEQFPMINPGVPIKRAHTPHIEPL
PSDHHTAADYLRQFDLLVLNFISRGNFVILPRLWNNSEVHRWFVNKDPNLITAILDITDS
ELKEDLLQSLMDSLGSNKHVLPEVCICFLSLLAEQESPHFQNLFLFFANMLLHYHQFMNP
NESDLNDVLMPASLSDDKIIKHMARRTLKLFVKNETPPKVTHEDLVKNRPRSPVRPPIPA
TAKTPDLPERH
              
                            

Download fasta file
RegulonDB