RegulonDB RegulonDB 10.9: Amino acid Sequence
putative selenoprotein YdfZ Amino Acid Sequence


Size: 67

Fasta

 

>putative selenoprotein YdfZ E. coli K12. Version NC_000913.3 GI:556503834
MTTYDRNRNAITTGSRVMVSGTGHTGKILSIDTEGLTAEQIRRGKTVVVEGCEEKLAPLD
LIRLGMN
              
                            

Download fasta file
RegulonDB