RegulonDB RegulonDB 10.9: Amino acid Sequence
Qin prophage; DUF1398 domain-containing protein YdfO Amino Acid Sequence


Size: 136

Fasta

 

>Qin prophage; DUF1398 domain-containing protein YdfO E. coli K12. Version NC_000913.3 GI:556503834
MDQVVIFKQIFDKVRNDLNYQWFYSELKRHNVSHYIYYLATENVHIVLKNDNTVLLKGLK
NIVSVKFSKDRHLIETTSNKLKSREITFQEYRRNLAKAGVFRWVTNIHEQKRYYYTFDNS
LLFTESIQKTTQILPR
              
                            

Download fasta file
RegulonDB