RegulonDB RegulonDB 10.9: Amino acid Sequence
Qin prophage; cold shock-like protein CspI Amino Acid Sequence


Size: 70

Fasta

 

>Qin prophage; cold shock protein CspI E. coli K12. Version NC_000913.3 GI:556503834
MSNKMTGLVKWFNPEKGFGFITPKDGSKDVFVHFSAIQSNDFKTLTENQEVEFGIENGPK
GPAAVHVVAL
              
                            

Download fasta file
RegulonDB