RegulonDB RegulonDB 10.9: Amino acid Sequence
Qin prophage; protein YdfR Amino Acid Sequence


Size: 103

Fasta

 

>Qin prophage; protein YdfR E. coli K12. Version NC_000913.3 GI:556503834
MTQDYELVVKGVRNFENKVTVTVALQDKERFDGEIFDLDVAMDRVEGAALEFYEAAARRS
VRQVFLEVAEKLSEKVESYLQHQYSFKIENPANKHERPHHKYL
              
                            

Download fasta file
RegulonDB