RegulonDB RegulonDB 10.9: Amino acid Sequence
Qin prophage; putative antitermination protein Q Amino Acid Sequence


Size: 250

Fasta

 

>Qin prophage; putative antitermination protein Q E. coli K12. Version NC_000913.3 GI:556503834
MNLEALPKYYSPKSPKLSDDAPATGTGCLTITDVMAAQGMVQSKAPLGLALFLAKVGVQD
PQFAIEGLLNYAMALDNPTLNKLSEEIRLQIIPYLVSFAFADYSRSAASKARCEHCSGTG
FYNVLREVVKHYRRGESVIKEEWVKELCQHCHGKGEASTACRGCKGKGIVLDEKRTRFHG
VPVYKICGRCNGNRFSRLPTTLARRHVQKLVPDLTDYQWYKGYADVIGKLVTKCWQEEAY
AEAQLRKVTR
              
                            

Download fasta file
RegulonDB