RegulonDB RegulonDB 10.9: Amino acid Sequence
putative zinc-binding dehydrogenase RspB Amino Acid Sequence


Size: 339

Fasta

 

>putative zinc-binding dehydrogenase RspB E. coli K12. Version NC_000913.3 GI:556503834
MKSILIEKPNQLAIVEREIPTPSAGEVRVKVKLAGICGSDSHIYRGHNPFAKYPRVIGHE
FFGVIDAVGEGVESARVGERVAVDPVVSCGHCYPCSIGKPNVCTTLAVLGVHADGGFSEY
AVVPAKNAWKIPEAVADQYAVMIEPFTIAANVTGHGQPTENDTVLVYGAGPIGLTIVQVL
KGVYNVKNVIVADRIDERLEKAKESGADWAINNSQTPLGEIFTEKGIKPTLIIDAACHPS
ILKEAVTLASPAARIVLMGFSSEPSEVIQQGITGKELSIFSSRLNANKFPIVIDWLSKGL
IKPEKLITHTFDFQHVADAISLFEQDQKHCCKVLLTFSE
              
                            

Download fasta file
RegulonDB