RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1283 domain-containing protein YnfB Amino Acid Sequence


Size: 113

Fasta

 

>DUF1283 domain-containing protein YnfB E. coli K12. Version NC_000913.3 GI:556503834
MKITLSKRIGLLAILLPCALALSTTVHAETNKLVIESGDSAQSRQHAAMEKEQWNDTRNL
RQKVNKRTEKEWDKADAAFDNRDKCEQSANINAYWEPNTLRCLDRRTGRVITP
              
                            

Download fasta file
RegulonDB