RegulonDB RegulonDB 10.8: Amino acid Sequence
spermidine N-acetyltransferase Amino Acid Sequence


Size: 186

Fasta

 

>spermidine N-acetyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MPSAHSVKLRPLEREDLRYVHQLDNNASVMRYWFEEPYEAFVELSDLYDKHIHDQSERRF
VVECDGEKAGLVELVEINHVHRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKL
YLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAIRMCIFQHQYLAEHKTPGQTL
LKPTAQ
              
                            

Download fasta file
RegulonDB