RegulonDB RegulonDB 10.9: Amino acid Sequence
redox enzyme maturation protein DmsD Amino Acid Sequence


Size: 204

Fasta

 

>redox enzyme maturation protein DmsD E. coli K12. Version NC_000913.3 GI:556503834
MTHFSQQDNFSVAARVLGALFYYAPESAEAAPLVAVLTSDGWETQWPLPEASLAPLVTAF
QTQCEETHAQAWQRLFVGPWALPSPPWGSVWLDRESVLFGDSTLALRQWMREKGIQFEMK
QNEPEDHFGSLLLMAAWLAENGRQTECEELLAWHLFPWSTRFLDVFIEKAEHPFYRALGE
LARLTLAQWQSQLLIPVAVKPLFR
              
                            

Download fasta file
RegulonDB