RegulonDB RegulonDB 11.0: Amino acid Sequence
multidrug/spermidine efflux pump membrane subunit MdtJ Amino Acid Sequence


Size: 121

Fasta

 

>multidrug/spermidine efflux pump membrane subunit MdtJ E. coli K12. Version NC_000913.3 GI:556503834
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA
YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA
V
              
                            

Download fasta file
RegulonDB