RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1471 domain-containing protein YdgH Amino Acid Sequence


Size: 314

Fasta

 

>DUF1471 domain-containing protein YdgH E. coli K12. Version NC_000913.3 GI:556503834
MKLKNTLLASALLSAMAFSVNAATELTPEQAAAVKPFDRVVVTGRFNAIGEAVKAVSRRA
DKEGAASFYVVDTSDFGNSGNWRVVADLYKADAEKAEETSNRVINGVVELPKDQAVLIEP
FDTVTVQGFYRSQPEVNDAITKAAKAKGAYSFYIVRQIDANQGGNQRITAFIYKKDAKKR
IVQSPDVIPADSEAGRAALAAGGEAAKKVEIPGVATTASPSSEVGRFFETQSSKGGRYTV
TLPDGTKVEELNKATAAMMVPFDSIKFSGNYGNMTEVSYQVAKRAAKKGAKYYHITRQWQ
ERGNNLTVSADLYK
              
                            

Download fasta file
RegulonDB