RegulonDB RegulonDB 10.9: Amino acid Sequence
putative arginine:ornithine antiporter Amino Acid Sequence


Size: 460

Fasta

 

>putative arginine:ornithine antiporter E. coli K12. Version NC_000913.3 GI:556503834
MEKKLGLSALTALVLSSMLGAGVFSLPQNMAAVASPAALLIGWGITGAGILLLAFAMLIL
TRIRPELDGGIFTYAREGFGELIGFCSAWGYWLCAVIANVSYLVIVFSALSFFTDTPELR
LFGDGNTWQSIVGASALLWIVHFLILRGVQTAASINLVATLAKLLPLGLFVVLAMMMFKL
DTFKLDFTGLALGVPVWEQVKNTMLITLWVFIGVEGAVVVSARARNKRDVGKATLLAVLS
ALGVYLLVTLLSLGVVARPELAEIRNPSMAGLMVEMMGPWGEIIIAAGLIVSVCGAYLSW
TIMAAEVPFLAATHKAFPRIFARQNAQAAPSASLWLTNICVQICLVLIWLTGSDYNTLLT
IASEMILVPYFLVGAFLLKIATRPLHKAVGVGACIYGLWLLYASGPMHLLLSVVLYAPGL
LVFLYARKTHTHDNVLNRQEMVLIGMLLIASVPATWMLVG
              
                            

Download fasta file
RegulonDB