RegulonDB RegulonDB 10.9: Amino acid Sequence
GlpM family protein Amino Acid Sequence


Size: 111

Fasta

 

>GlpM family protein E. coli K12. Version NC_000913.3 GI:556503834
MGLVIKAALGALVVLLIGVLAKTKNYYIAGLIPLFPTFALIAHYIVASERGIEALRATII
FSMWSIIPYFVYLVSLWYFTGMMRLPAAFVGSVACWGISAWVLIICWIKLH
              
                            

Download fasta file
RegulonDB