RegulonDB RegulonDB 11.0: Amino acid Sequence
DUF2569 domain-containing inner membrane protein YdgK Amino Acid Sequence


Size: 146

Fasta

 

>DUF2569 domain-containing inner membrane protein YdgK E. coli K12. Version NC_000913.3 GI:556503834
MTTTTPQRIGGWLLGPLAWLLVALLSTTLALLLYTAALSSPQTFQTLGGQALTTQILWGV
SFITAIALWYYTLWLTIAFFKRRRCVPKHYIIWLLISVLLAVKAFAFSPVEDGIAVRQLL
FTLLATALIVPYFKRSSRVKATFVNP
              
                            

Download fasta file
RegulonDB