RegulonDB RegulonDB 11.0: Amino acid Sequence
SoxR [2Fe-2S] reducing system protein RsxB Amino Acid Sequence


Size: 192

Fasta

 

>SoxR [2Fe-2S] reducing system protein RsxB E. coli K12. Version NC_000913.3 GI:556503834
MNAIWIAVAAVSLLGLAFGAILGYASRRFAVEDDPVVEKIDEILPQSQCGQCGYPGCRPY
AEAISCNGEKINRCAPGGEAVMLKIAELLNVEPQPLDGEAQEITPARMVAVIDENNCIGC
TKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISLQPVAETPDSWKWDLNT
IPVRIIPVEHHA
              
                            

Download fasta file
RegulonDB