RegulonDB RegulonDB 10.9: Amino acid Sequence
SoxR [2Fe-2S] reducing system protein RsxC Amino Acid Sequence


Size: 740

Fasta

 

>SoxR [2Fe-2S] reducing system protein RsxC E. coli K12. Version NC_000913.3 GI:556503834
MLKLFSAFRKNKIWDFNGGIHPPEMKTQSNGTPLRQVPLAQRFVIPLKQHIGAEGELCVS
VGDKVLRGQPLTRGRGKMLPVHAPTSGTVTAIAPHSTAHPSALAELSVIIDADGEDCWIP
RDGWADYRTRSREELIERIHQFGVAGLGGAGFPTGVKLQGGGDKIETLIINAAECEPYIT
ADDRLMQDCAAQVVEGIRILAHILQPREILIGIEDNKPQAISMLRAVLADSNDISLRVIP
TKYPSGGAKQLTYILTGKQVPHGGRSSDIGVLMQNVGTAYAVKRAVIDGEPITERVVTLT
GEAIARPGNVWARLGTPVRHLLNDAGFCPSADQMVIMGGPLMGFTLPWLDVPVVKITNCL
LAPSANELGEPQEEQSCIRCSACADACPADLLPQQLYWFSKGQQHDKATTHNIADCIECG
ACAWVCPSNIPLVQYFRQEKAEIAAIRQEEKRAAEAKARFEARQARLEREKAARLERHKS
AAVQPAAKDKDAIAAALARVKEKQAQATQPIVIKAGERPDNSAIIAAREARKAQARAKQA
ELQQTNDAATVADPRKTAVEAAIARAKARKLEQQQANAEPEQQVDPRKAAVEAAIARAKA
RKLEQQQANAEPEEQVDPRKAAVEAAIARAKARKLEQQQANAEPEQQVDPRKAAVEAAIA
RAKARKREQQPANAEPEEQVDPRKAAVEAAIARAKARKLEQQQANAVPEEQVDPRKAAVA
AAIARAQAKKAAQQKVVNED
              
                            

Download fasta file
RegulonDB