RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1289 domain-containing protein YdhL Amino Acid Sequence


Size: 79

Fasta

 

>DUF1289 domain-containing protein YdhL E. coli K12. Version NC_000913.3 GI:556503834
MAEQLEFFPVQSPCRGICQSDERGFCRGCFRSRDERFNWNKMSDGEKQEVLRLCRQRLMR
KLRANKPASSDEPEQPSLF
              
                            

Download fasta file
RegulonDB