RegulonDB RegulonDB 10.9: Amino acid Sequence
N-ethylmaleimide reductase Amino Acid Sequence


Size: 365

Fasta

 

>N-ethylmaleimide reductase E. coli K12. Version NC_000913.3 GI:556503834
MSSEKLYSPLKVGAITAANRIFMAPLTRLRSIEPGDIPTPLMAEYYRQRASAGLIISEAT
QISAQAKGYAGAPGIHSPEQIAAWKKITAGVHAENGHMAVQLWHTGRISHASLQPGGQAP
VAPSALSAGTRTSLRDENGQAIRVETSMPRALELEEIPGIVNDFRQAIANAREAGFDLVE
LHSAHGYLLHQFLSPSSNHRTDQYGGSVENRARLVLEVVDAGIEEWGADRIGIRVSPIGT
FQNTDNGPNEEADALYLIEQLGKRGIAYLHMSEPDWAGGEPYTDAFREKVRARFHGPIIG
AGAYTVEKAETLIGKGLIDAVAFGRDWIANPDLVARLQRKAELNPQRAESFYGGGAEGYT
DYPTL
              
                            

Download fasta file
RegulonDB