RegulonDB RegulonDB 10.9: Amino acid Sequence
peptidoglycan DD-endopeptidase MepH Amino Acid Sequence


Size: 271

Fasta

 

>peptidoglycan DD-endopeptidase MepH E. coli K12. Version NC_000913.3 GI:556503834
MARINRISITLCALLFTTLPLTPMAHASKQARESSATTHITKKADKKKSTATTKKTQKTA
KKAASKSTTKSKTASSVKKSSITASKNAKTRSKHAVNKTASASFTEKCTKRKGYKSHCVK
VKNAASGTLADAHKAKVQKATKVAMNKLMQQIGKPYRWGGSSPRTGFDCSGLVYYAYKDL
VKIRIPRTANEMYHLRDAAPIERSELKNGDLVFFRTQGRGTADHVGVYVGNGKFIQSPRT
GQEIQITSLSEDYWQRHYVGARRVMTPKTLR
              
                            

Download fasta file
RegulonDB