RegulonDB RegulonDB 10.9: Amino acid Sequence
FAD/NAD(P) binding domain-containing protein YdhS Amino Acid Sequence


Size: 534

Fasta

 

>FAD/NAD(P) binding domain-containing protein YdhS E. coli K12. Version NC_000913.3 GI:556503834
MKKIAIVGAGPTGIYTLFSLLQQQTPLSISIFEQADEAGVGMPYSDEENSKMMLANIASI
EIPPIYCTYLEWLQKQEDSHLQRYGVKKETLHDRQFLPRILLGEYFRDQFLRLVDQARQQ
KFAVAVYESCQVTDLQITNAGVMLATNQDLPSETFDLAVIATGHVWPDEEEATRTYFPSP
WSGLMEAKVDACNVGIMGTSLSGLDAAMAVAIQHGSFIEDDKQHVVFHRDNASEKLNITL
LSRTGILPEADFYCPIPYEPLHIVTDQALNAEIQKGEEGLLDRVFRLIVEEIKFADPDWS
QRIALESLNVDSFAQAWFAERKQRDPFDWAEKNLQEVERNKREKHTVPWRYVILRLHEAV
QEIVPHLNEHDHKRFSKGLARVFIDNYAAIPSESIRRLLALREAGIIHILALGEDYKMEI
NESRTVLKTEDNSYSFDVFIDARGQRPLKVKDIPFPGLREQLQKTGDEIPDVGEDYTLQQ
PEDIRGRVAFGALPWLMHDQPFVQGLTACAEIGEAMARAVVKPASRARRRLSFD
              
                            

Download fasta file
RegulonDB