RegulonDB RegulonDB 10.8: Amino acid Sequence
uncharacterized protein YdhT Amino Acid Sequence


Size: 270

Fasta

 

>uncharacterized protein YdhT E. coli K12. Version NC_000913.3 GI:556503834
MIITQADLREWRIGAVMYRWFLRHFPRGGSYADIHHALIEEGYTDWAESLVEYAWKKWLA
DENFAHQEVSSMQKLATDPGERPFCSQFARSDDHARIGCCEDNARIATAGYAAQIASMGY
SVRIGSVGFNSHIGSSGERARVAVTGNSSRISSAGDSSRIANTGMRVRVCTLGERCHVAS
NGDLVQIASFGANARIANSGDNVHIIASGENSTVVSTGVVDSIILGPGGSAALAYHDGER
VRFAVAIEGENNIRAGVRYRLNEQHQFVEC
              
                            

Download fasta file
RegulonDB