RegulonDB RegulonDB 10.9: Amino acid Sequence
fumarase D Amino Acid Sequence


Size: 69

Fasta

 

>fumarase D E. coli K12. Version NC_000913.3 GI:556503834
MGNRTKEDELYREMCRVVGKVVLEMRDLGQEPKHIVIAGVLRTALANKRIQRSELEKQAM
ETVINALVK
              
                            

Download fasta file
RegulonDB