RegulonDB RegulonDB 10.10: Amino acid Sequence
Fe-S cluster scaffold complex subunit SufC Amino Acid Sequence


Size: 248

Fasta

 

>Fe-S cluster scaffold complex subunit SufC E. coli K12. Version NC_000913.3 GI:556503834
MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTV
EFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDF
QDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDA
LKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQG
YGWLTEQQ
              
                            

Download fasta file
RegulonDB