RegulonDB RegulonDB 11.0: Amino acid Sequence
uncharacterized protein YdiH Amino Acid Sequence


Size: 62

Fasta

 

>protein YdiH E. coli K12. Version NC_000913.3 GI:556503834
MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG
VH
              
                            

Download fasta file
RegulonDB