RegulonDB RegulonDB 11.1: Amino acid Sequence
putative FAD-linked oxidoreductase YdiJ Amino Acid Sequence


Size: 1018

Fasta

 

>putative FAD-linked oxidoreductase E. coli K12. Version NC_000913.3 GI:556503834
MIPQISQAPGVVQLVLNFLQELEQQGFTGDTATSYADRLTMSTDNSIYQLLPDAVVFPRS
TADVALIARLAAQERYSSLIFTPRGGGTGTNGQALNQGIIVDMSRHMNRIIEINPEEGWV
RVEAGVIKDQLNQYLKPFGYFFAPELSTSNRATLGGMINTDASGQGSLVYGKTSDHVLGV
RAVLLGGDILDTQPLPVELAETLGKSNTTIGRIYNTVYQRCRQQRQLIIDNFPKLNRFLT
GYDLRHVFNDEMTEFDLTRILTGSEGTLAFITEARLDITRLPKVRRLVNVKYDSFDSALR
NAPFMVEARALSVETVDSKVLNLAREDIVWHSVSELITDVPDQEMLGLNIVEFAGDDEAL
IDERVNALCARLDELIASHQAGVIGWQVCRELAGVERIYAMRKKAVGLLGNAKGAAKPIP
FAEDTCVPPEHLADYIAEFRALLDSHGLSYGMFGHVDAGVLHVRPALDMCDPQQEILMKQ
ISDDVVALTAKYGGLLWGEHGKGFRAEYSPAFFGEELFAELRKVKAAFDPHNRLNPGKIC
PPEGLDAPMMKVDAVKRGTFDRQIPIAVRQQWRGAMECNGNGLCFNFDARSPMCPSMKIT
QNRIHSPKGRATLVREWLRLLADRGVDPLKLEQELPESGVSLRTLIARTRNSWHANKGEY
DFSHEVKEAMSGCLACKACSTQCPIKIDVPEFRSRFLQLYHTRYLRPLRDHLVATVESYA
PLMARAPKTFNFFINQPLVRKLSEKHIGMVDLPLLSVPSLQQQMVGHRSANMTLEQLESL
NAEQKARTVLVVQDPFTSYYDAQVVADFVRLVEKLGFQPVLLPFSPNGKAQHIKGFLNRF
AKTAKKTADFLNRMAKLGMPMVGVDPALVLCYRDEYKLALGEERGEFNVLLANEWLASAL
ESQPVATVSGESWYFFGHCTEVTALPGAPAQWAAIFARFGAKLENVSVGCCGMAGTYGHE
AKNHENSLGIYELSWHQAMQRLPRNRCLATGYSCRSQVKRVEGTGVRHPVQALLEIIK
              
                            

Download fasta file
RegulonDB