RegulonDB RegulonDB 11.0: Amino acid Sequence
DUF1870 domain-containing protein YdiL Amino Acid Sequence


Size: 118

Fasta

 

>DUF1870 domain-containing protein YdiL E. coli K12. Version NC_000913.3 GI:556503834
MNAYELQALRHIFAMTIDECATWIAQTGDSESWRQWENGKCAIPDRVVEQLLAMRQQRKK
HLHAIIEKINNRIGNNTMRFFPDLTAFQRVYPDGNFIDWKIYQSVAAELYAHDLERLC
              
                            

Download fasta file
RegulonDB