RegulonDB RegulonDB 11.0: Amino acid Sequence
putative acyl-CoA dehydrogenase YdiO Amino Acid Sequence


Size: 383

Fasta

 

>putative acyl-CoA dehydrogenase YdiO E. coli K12. Version NC_000913.3 GI:556503834
MDFSLTEEQELLLASIRELITTNFPEEYFRTCDQNGTYPREFMRALADNGISMLGVPEEF
GGIPADYVTQMLALMEVSKCGAPAFLITNGQCIHSMRRFGSAEQLRKTAESTLETGDPAY
ALALTEPGAGSDNNSATTTYTRKNGKVYINGQKTFITGAKEYPYMLVLARDPQPKDPKKA
FTLWWVDSSKPGIKINPLHKIGWHMLSTCEVYLDNVEVEESDMVGEEGMGFLNVMYNFEM
ERLINAARSTGFAECAFEDAARYANQRIAFGKPIGHNQMIQEKLALMAIKIDNMRNMVLK
VAWQADQHQSLRTSAALAKLYCARTAMEVIDDAIQIMGGLGYTDEARVSRFWRDVRCERI
GGGTDEIMIYVAGRQILKDYQNK
              
                            

Download fasta file
RegulonDB