RegulonDB RegulonDB 10.9: Amino acid Sequence
putative electron transfer flavoprotein subunit YdiQ Amino Acid Sequence


Size: 254

Fasta

 

>putative electron transfer flavoprotein subunit YdiQ E. coli K12. Version NC_000913.3 GI:556503834
MKIITCFKLVPEEQDIVVTPEYTLNFDNADAKISQFDLNAIEAASQLATDDDEIAALTVG
GSLLQNSKVRKDVLSRGPHSLYLVQDAQLEHALPLDTAKALAAAIEKIGFDLLIFGEGSG
DLYAQQVGLLVGEILQLPVINAVSAIQRQGNTLVIERTLEDDVEVIELSVPAVLCVTSDI
NVPRIPSMKAILGAGKKPVNQWQASDIDWSQSAPLAELVGIRVPPQTERKHIIIDNDSPE
AIAELAEHLKKALN
              
                            

Download fasta file
RegulonDB