RegulonDB RegulonDB 10.10: Amino acid Sequence
putative ankyrin repeat protein B, N-terminal fragment Amino Acid Sequence


Size: 632

Fasta

 

>putative ankyrin repeat protein B, N-terminal fragment E. coli K12. Version NC_000913.3 GI:556503834
MSQNDIIIRTHYKSPHRLHIDSDIPTPSSEPINQFARQLITLLDTSDLSSMLSYCVTQEF
TANCRKISQNCYSTALFTINFATSPIHTENILITLHYKKEIISLLLETTPIKANHLRSIL
DYIEQEQLTAEDRNHCMKLSKKIHREKNYTPNSKSQW*CMFFAISF*RYFLSPSVIAIRP
*FIEKWKRQSQPD*TLLLR*IHTAACPLSPGRGVQSITSPSSCRESRYRE*GFWLRFRYF
LLSNDGKQCQSYVRDFIYRQSYFVSKATNKAVSVWTIKLCCVRLRPERYQRCRQRHPQDS
TGLSFA**VHQFRSRCSDLG**ICSQLCNCYSAPITCGSSRGYFRGYCITNAICPYTSIG
NVVNNGYRPVSTAYYIIQTVAHTP*KRNH*NNNCAE*RWYTCFIFGYDERTY*QRENIYA
RNSVTGR*SHHS*R*SG*ITAN*KC*RNTWTLYLHVVWIR*NNRYLSECINHSNSTRAFK
QKTGDEYFSHENT*W*ARIIRRNGK*SPFVCHTVPL*N*WHRL*IQVEQS*HHGFIKRSY
STGNPCIIHRHEQG**RRRVILYIDAGCFCKKTFF*STSVIYTIGR*KS*QHVSCSYSHS
S*AL*NCRNILCCY*CNQPKPEF*C**NKDVF
              
                            

Download fasta file
RegulonDB