RegulonDB RegulonDB 10.8: Amino acid Sequence
acid-inducible putative outer membrane protein YdiY Amino Acid Sequence


Size: 252

Fasta

 

>acid-inducible putative outer membrane protein YdiY E. coli K12. Version NC_000913.3 GI:556503834
MKLLKTVPAIVMLAGGMFASLNAAADDSVFTVMDDPASAKKPFEGNLNAGYLAQSGNTKS
SSLTADTTMTWYGHTTAWSLWGNASNTSSNDERSSEKYAAGGRSRFNLTDYDYLFGQASW
LTDRYNGYRERDVLTAGYGRQFLNGPVHSFRFEFGPGVRYDKYTDNASETQPLGYASGAY
AWQLTDNAKFTQGVSVFGAEDTTLNSESALNVAINEHFGLKVAYNVTWNSEPPESAPEHT
DRRTTLSLGYSM
              
                            

Download fasta file
RegulonDB