RegulonDB RegulonDB 10.9: Amino acid Sequence
cell division modulator Amino Acid Sequence


Size: 80

Fasta

 

>cell division modulator E. coli K12. Version NC_000913.3 GI:556503834
MKKPLRQQNRQIISYVPRTEPAPPEHAIKMDSFRDVWMLRGKYVAFVLMGESFLRSPAFT
VPESAQRWANQIRQEGEVTE
              
                            

Download fasta file
RegulonDB