RegulonDB RegulonDB 10.9: Amino acid Sequence
arginine N-succinyltransferase Amino Acid Sequence


Size: 344

Fasta

 

>arginine N-succinyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MMVIRPVERSDVSALMQLASKTGGGLTSLPANEATLSARIERAIKTWQGELPKSEQGYVF
VLEDSETGTVAGICAIEVAVGLNDPWYNYRVGTLVHASKELNVYNALPTLFLSNDHTGSS
ELCTLFLDPDWRKEGNGYLLSKSRFMFMAAFRDKFNDKVVAEMRGVIDEHGYSPFWQSLG
KRFFSMDFSRADFLCGTGQKAFIAELMPKHPIYTHFLSQEAQDVIGQVHPQTAPARAVLE
KEGFRYRNYIDIFDGGPTLECDIDRVRAIRKSRLVEVAEGQPAQGDFPACLVANENYHHF
RVVLVRTDPATERLILTAAQLDALKCHAGDRVRLVRLCAEEKTA
              
                            

Download fasta file
RegulonDB