RegulonDB RegulonDB 10.9: Amino acid Sequence
molybdopterin synthase sulfurtransferase Amino Acid Sequence


Size: 435

Fasta

 

>molybdopterin synthase sulfurtransferase E. coli K12. Version NC_000913.3 GI:556503834
MKRVSQMTALAMALGLACASSWAAELAKPLTLDQLQQQNGKAIDTRPSAFYNGWPQTLNG
PSGHELAALNLSASWLDKMSTEQLNAWIKQHNLKTDAPVALYGNDKDVDAVKTRLQKAGL
THISILSDALSEPSRLQKLPHFEQLVYPQWLHDLQQGKEVTAKPAGDWKVIEAAWGAPKL
YLISHIPGADYIDTNEVESEPLWNKVSDEQLKAMLAKHGIRHDTTVILYGRDVYAAARVA
QIMLYAGVKDVRLLDGGWQTWSDAGLPVERGTPPKVKAEPDFGVKIPAQPQLMLDMEQAR
GLLHRQDASLVSIRSWPEFIGTTSGYSYIKPKGEIAGARWGHAGSDSTHMEDFHNPDGTM
RSADDITAMWKAWNIKPEQQVSFYCGTGWRASETFMYARAMGWKNVSVYDGGWYEWSSDP
KNPVATGERGPDSSK
              
                            

Download fasta file
RegulonDB