RegulonDB RegulonDB 10.9: Amino acid Sequence
CDP-alcohol phosphatidyltransferase domain-containing protein YnjF Amino Acid Sequence


Size: 206

Fasta

 

>CDP-alcohol phosphatidyltransferase domain-containing protein YnjF E. coli K12. Version NC_000913.3 GI:556503834
MLDRHLHPRIKPLLHQCVRVLDKPGITPDGLTLVGFAIGVLALPFLALGWYLAALVVILL
NRLLDGLDGALARRRELTDAGGFLDISLDFLFYALVPFGFILAAPEQNALAGGWLLFAFI
GTGSSFLAFAALAAKHQIDNPGYAHKSFYYLGGLTEGTETILLFVLGCLFPAWFAWFAWI
FGALCWMTTFTRVWSGYLTLKSLQRQ
              
                            

Download fasta file
RegulonDB