RegulonDB RegulonDB 10.9: Amino acid Sequence
mischarged aminoacyl-tRNA deacylase Amino Acid Sequence


Size: 167

Fasta

 

>mischarged aminoacyl-tRNA deacylase E. coli K12. Version NC_000913.3 GI:556503834
MTEMAKGSVTHQRLIALLSQEGADFRVVTHEAVGKCEAVSEIRGTALGQGAKALVCKVKG
NGVNQHVLAILAADQQADLSQLASHIGGLRASLASPAEVDELTGCVFGAIPPFSFHPKLK
LVADPLLFERFDEIAFNAGMLDKSVILKTADYLRIAQPELVNFRRTA
              
                            

Download fasta file
RegulonDB