RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF441 domain-containing inner membrane protein YeaL Amino Acid Sequence


Size: 148

Fasta

 

>DUF441 domain-containing inner membrane protein YeaL E. coli K12. Version NC_000913.3 GI:556503834
MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPLSTFFPWIEKQGLSIGIIILTI
GVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQPQLVAGLLVGT
VLGVALFRGVPVGPLIAAGLVSLIVGKQ
              
                            

Download fasta file
RegulonDB