RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF488 domain-containing protein YeaO Amino Acid Sequence


Size: 115

Fasta

 

>DUF488 domain-containing protein YeaO E. coli K12. Version NC_000913.3 GI:556503834
MNIQCKRVYDPAEQSDGYRILVDRLWPRGIKKTDLALDEWDKEITPSTELRKAFHGEVVD
YATFREQYLAELAQHEQEGKRLADIAKKQPLTLLYSAKNTTQNHALVLADWLRSL
              
                            

Download fasta file
RegulonDB