RegulonDB RegulonDB 10.9: Amino acid Sequence
PF04226 family protein YeaQ Amino Acid Sequence


Size: 82

Fasta

 

>PF04226 family protein YeaQ E. coli K12. Version NC_000913.3 GI:556503834
MGILSWIIFGLIAGILAKWIMPGKDGGGFFMTILLGIVGAVVGGWISTLFGFGKVDGFNF
GSFVVAVIGAIVVLFIYRKIKS
              
                            

Download fasta file
RegulonDB