RegulonDB RegulonDB 10.9: Amino acid Sequence
carnitine monooxygenase subunit YeaW Amino Acid Sequence


Size: 374

Fasta

 

>carnitine monooxygenase subunit YeaW E. coli K12. Version NC_000913.3 GI:556503834
MSNLSPDFVLPENFCANPQEAWTIPARFYTDQNAFEHEKENVFAKSWICVAHSSELANAN
DYVTREIIGESIVLVRGRDKVLRAFYNVCPHRGHQLLSGEGKAKNVITCPYHAWAFKLDG
NLAHARNCENVANFDSDKAQLVPVRLEEYAGFVFINMDPNATSVEDQLPGLGAKVLEACP
EVHDLKLAARFTTRTPANWKNIVDNYLECYHCGPAHPGFSDSVQVDRYWHTMHGNWTLQY
GFAKPSEQSFKFEEGTDAAFHGFWLWPCTMLNVTPIKGMMTVIYEFPVDSETTLQNYDIY
FTNEELTDEQKSLIEWYRDVFRPEDLRLVESVQKGLKSRGYRGQGRIMADSSGSGISEHG
IAHFHNLLAQVFKD
              
                            

Download fasta file
RegulonDB