RegulonDB RegulonDB 10.10: Amino acid Sequence
N6-L-threonylcarbamoyladenine synthase, TsaB subunit Amino Acid Sequence


Size: 231

Fasta

 

>N6-L-threonylcarbamoyladenine synthase, TsaB subunit E. coli K12. Version NC_000913.3 GI:556503834
MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALA
YGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMG
EVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLV
LRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKE
              
                            

Download fasta file
RegulonDB