RegulonDB RegulonDB 10.9: Amino acid Sequence
putative ATP-dependent 5' to 3' DNA helicase Amino Acid Sequence


Size: 636

Fasta

 

>putative 5' to 3' DNA helicase implicated in DNA repair E. coli K12. Version NC_000913.3 GI:556503834
MTDDFAPDGQLAKAIPGFKPREPQRQMAVAVTQAIEKGQPLVVEAGTGTGKTYAYLAPAL
RAKKKVIISTGSKALQDQLYSRDLPTVSKALKYTGNVALLKGRSNYLCLERLEQQALAGG
DLPVQILSDVILLRSWSNQTVDGDISTCVSVAEDSQAWPLVTSTNDNCLGSDCPMYKDCF
VVKARKKAMDADVVVVNHHLFLADMVVKESGFGELIPEADVMIFDEAHQLPDIASQYFGQ
SLSSRQLLDLAKDITIAYRTELKDTQQLQKCADRLAQSAQDFRLQLGEPGYRGNLRELLA
NPQIQRAFLLLDDTLELCYDVAKLSLGRSALLDAAFERATLYRTRLKRLKEINQPGYSYW
YECTSRHFTLALTPLSVADKFKELMAQKPGSWIFTSATLSVNDDLHHFTSRLGIEQAESL
LLPSPFDYSRQALLCVLRNLPQTNQPGSARQLAAMLRPIIEANNGRCFMLCTSHAMMRDL
AEQFRATMTLPVLLQGETSKGQLLQQFVSAGNALLVATSSFWEGVDVRGDTLSLVIIDKL
PFTSPDDPLLKARMEDCRLRGGDPFDEVQLPDAVITLKQGVGRLIRDADDRGVLVICDNR
LVMRPYGATFLASLPPAPRTRDIARAVRFLAIPSSR
              
                            

Download fasta file
RegulonDB